PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 450aa    MW: 48439.5 Da    PI: 6.3002
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.1e-16245301359
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                     + kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k+l  +++++ + 
  XP_009787496.1 245 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEA 301
                     689*****************************************9999999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-12242299No hitNo description
SMARTSM003381.7E-19243307IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.679245300IPR004827Basic-leucine zipper domain
PfamPF001701.3E-13246299IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11247297No hitNo description
CDDcd147022.97E-6248299No hitNo description
PROSITE patternPS000360250265IPR004827Basic-leucine zipper domain
PfamPF124987.5E-48314439IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MDRVFSVDDD IGDHFWSTPP TADLGVDSPT TATAASYSKM MNRSSSEWAF QRFLQEATAA  60
GTSTSSHPQP PTMTASSSSS SHQNDVVEIK DENLSTPNLN PSTALNSKPA SSFGLTPPPN  120
IAVDSEEYQA FLKSQLHLAC AAVALTRGKS LNPQDSGSTA HDKGSETASA AQSGSHVSTL  180
GSSQEMAKIQ DKDAGGPVGI PSLPPVQKKP VVQVRSTTSG SSREQSDDDE AEGEAETTQG  240
MDPADAKRVR RMLSNRESAR RSRRRKQAHL TELETQVSQL RVENSSLLKR LTDISQKYNE  300
AAVDNRVLKA DVETLRAKVK MAEETVKRVT GLNPLFQAMS EISSMVMPSY SGSPSDTSAD  360
AAVPVQDDPK HHYYQQPPNN HMPTNDPRIQ NGMVDVPPIE NVQQNPATAA VGGNKMGRTA  420
SMQRVASLEH LQKRIRGEIS SCGTQGRGEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259266RRSRRRKQ
2261266SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0616480.0AY061648.1 Nicotiana tabacum bZIP transcription factor (BZI-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787496.10.0PREDICTED: light-inducible protein CPRF2-like
RefseqXP_016450151.10.0PREDICTED: light-inducible protein CPRF2-like
SwissprotQ990901e-148CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLQ93YM70.0Q93YM7_TOBAC; BZIP transcription factor
STRINGPGSC0003DMT4000500960.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-74bZIP family protein